Product Name
Tetraspanin 12 (TSPAN12), Polyclonal Antibody
Full Product Name
Tetraspanin 12 antibody
Product Synonym Names
Polyclonal Tetraspanin 12; Anti-Tetraspanin 12; TM4SF12; Tetraspanin 12; Tetraspanin -12; NET-2; TSPAN12
Product Gene Name
anti-TSPAN12 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Species Reactivity
Human, Mouse, Rat, Dog
Specificity
Tetraspanin 12 antibody was raised against the middle region of TSPAN12
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of TSPAN12 antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
TSPAN12 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.
Immunogen
Tetraspanin 12 antibody was raised using the middle region of TSPAN12 corresponding to a region with amino acids EFPGCSKQAHQEDLSDLYQEGCGKKMYSFLRGTKQLQVLRFLGISIGVTQ
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-TSPAN12 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-TSPAN12 antibody
Rabbit polyclonal Tetraspanin 12 antibody raised against the middle region of TSPAN12
Product Categories/Family for anti-TSPAN12 antibody
Cell Biology; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-TSPAN12 antibody
Western Blot (WB)
Application Notes for anti-TSPAN12 antibody
WB: 0.25 ug/ml
Western Blot (WB) of anti-TSPAN12 antibody
Tetraspanin 12 antibody (MBS5302795) used at 0.25 ug/ml to detect target protein.

NCBI/Uniprot data below describe general gene information for TSPAN12. It may not necessarily be applicable to this product.
NCBI Accession #
AAH31265.1
[Other Products]
UniProt Secondary Accession #
Q549U9; Q8N5Y0; A4D0V8; B4DRG6[Other Products]
UniProt Related Accession #
O95859[Other Products]
Molecular Weight
35 kDa (MW of target protein)[Similar Products]
NCBI Official Full Name
Tetraspanin 12
NCBI Official Synonym Full Names
tetraspanin 12
NCBI Official Symbol
TSPAN12??[Similar Products]
NCBI Official Synonym Symbols
EVR5; NET2; NET-2; TM4SF12
??[Similar Products]
NCBI Protein Information
tetraspanin-12
UniProt Protein Name
Tetraspanin-12
UniProt Synonym Protein Names
Tetraspan NET-2; Transmembrane 4 superfamily member 12
UniProt Gene Name
TSPAN12??[Similar Products]
UniProt Synonym Gene Names
NET2; TM4SF12; Tspan-12??[Similar Products]
UniProt Entry Name
TSN12_HUMAN
NCBI Summary for TSPAN12
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. [provided by RefSeq, Jul 2008]
UniProt Comments for TSPAN12
TSPAN12: a multi-pass membrane protein. Member of the transmembrane 4 superfamily, also known as the tetraspanin family. Plays a central role in retinal vascularization by regulating norrin (NDP) signal transduction. Acts in concert with norrin (NDP) to promote FZD4 multimerization and subsequent activation of FZD4, leading to promote accumulation of beta-catenin (CTNNB1) and stimulate LEF/TCF-mediated transcriptional programs. Suprisingly, it only activate the norrin (NDP)-dependent activation of FZD4, while it does not activate the Wnt-dependent activation of FZD4, suggesting the existence of a Wnt-independent signaling that also promote accumulation the beta-catenin (CTNNB1). Acts as a regulator of membrane proteinases such as ADAM10 and MMP14/MT1-MMP. Activates ADAM10-dependent cleavage activity of amyloid precursor protein (APP). Activates MMP14/MT1-MMP-dependent cleavage activity. Defects in TSPAN12 are the cause of vitreoretinopathy exudative type 5 (EVR5). It is a disorder of the retinal vasculature characterized by an abrupt cessation of growth of peripheral capillaries, leading to an avascular peripheral retina. Twp isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; Membrane protein, integral; Receptor, misc.
Chromosomal Location of Human Ortholog: 7q31.31
Cellular Component: membrane; integral to plasma membrane; integral to membrane
Molecular Function: Wnt receptor activity
Biological Process: cell surface receptor linked signal transduction; angiogenesis; regulation of angiogenesis
Disease: Exudative Vitreoretinopathy 5
Research Articles on TSPAN12
1. Novel mutations have been described in the TSPAN12 gene in Chinese patients with familial exudative vitreoretinopathy.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.