Full Product Name
MOUSE ANTI HUMAN AMH
Product Synonym Names
MIF
Product Gene Name
anti-AMH antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for P03971
Species Reactivity
Baboon, Mouse, Sheep, Squirrel monkey; NB Antibody activity and working conditions may vary between species
Form/Format
Concentrated Tissue Culture Supernatant - liquid; Con S/N
Perservative Stabilisers
0.1% Sodium Azide
Fusion Partners
Spleen cells from immunised T/O outbred mice were fused with cells of the SP2/0 myeloma line
Immunogen
Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC)
Histology Positive Control Tissue
Ovary
Preparation and Storage
Store at 4 degree C or at -20 degree C if preferred. This product should be stored undiluted. Storage in frost-free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use.
Shelf Life: 18 months from date of despatch
Other Notes
Small volumes of anti-AMH antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-AMH antibody
Mouse anti Human AMH, clone 5/6 recognizes human anti-mullerian hormone (AMH), originally classified as a foetal testicular hormone that inhibits Mullerian duct development. AMH is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. AMH plays a role in testicular differentiation and in the regulation of ovarian follicle growth. AMH is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kDa disulphide linked precursor that is cleaved to release the mature 30kDa homodimer.
Applications Tested/Suitable for anti-AMH antibody
Immunohistology Paraffin, Western Blot (WB)
Application Notes for anti-AMH antibody
Immunohistology - Paraffin Dilution: 1/20-1/40
Application Note:This product requires antigen retrieval using heat treatment prior to staining of paraffin sections. Sodium citrate buffer pH 6.0 is recommended for this purpose.
Testing Data of anti-AMH antibody
AMH - MBS215705 staining of ovary tissue from a 25 day old mouse. Formalin fixed paraffin processed tissue

NCBI/Uniprot data below describe general gene information for AMH. It may not necessarily be applicable to this product.
NCBI Accession #
NP_000470.2
[Other Products]
NCBI GenBank Nucleotide #
NM_000479.3
[Other Products]
UniProt Primary Accession #
P03971
[Other Products]
UniProt Secondary Accession #
O75246; Q6GTN3[Other Products]
UniProt Related Accession #
P03971[Other Products]
NCBI Official Full Name
muellerian-inhibiting factor
NCBI Official Synonym Full Names
anti-Mullerian hormone
NCBI Official Symbol
AMH??[Similar Products]
NCBI Official Synonym Symbols
MIF; MIS
??[Similar Products]
NCBI Protein Information
muellerian-inhibiting factor; Mullerian inhibiting factor; Mullerian inhibiting substance; anti-Muellerian hormone; muellerian-inhibiting substance
UniProt Protein Name
Muellerian-inhibiting factor
UniProt Synonym Protein Names
Anti-Muellerian hormone; AMH; Muellerian-inhibiting substance; MIS
Protein Family
Muellerian-inhibiting factor
UniProt Gene Name
AMH??[Similar Products]
UniProt Synonym Gene Names
MIF; AMH; MIS??[Similar Products]
UniProt Entry Name
MIS_HUMAN
NCBI Summary for AMH
Anti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome. [provided by RefSeq, Jul 2008]
UniProt Comments for AMH
AMH: This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin. Defects in AMH are the cause of persistent Muellerian duct syndrome type 1 (PMDS1). PMDS1 is a form of male pseudohermaphroditism characterized by a failure of Muellerian duct regression in otherwise normal males. Belongs to the TGF-beta family.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 19p13.3
Cellular Component: extracellular space; cytoplasm; extracellular region
Molecular Function: growth factor activity; hormone activity; transforming growth factor beta receptor binding; receptor binding
Biological Process: sex determination; response to drug; Mullerian duct regression; cell-cell signaling; gonadal mesoderm development; preantral ovarian follicle growth; sex differentiation; response to organic cyclic substance; urogenital system development; aging; activation of NF-kappaB transcription factor
Disease: Persistent Mullerian Duct Syndrome, Types I And Ii
Research Articles on AMH
1. This study presents a comparison of the serum levels of Anti-Mullerian Hormone in major phenotypes of polycystic ovarian syndrome (A, B, C, D).
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.