Product Name
Lamin B Receptor (LBR), Polyclonal Antibody
Full Product Name
Lamin B Receptor antibody
Product Synonym Names
Polyclonal Lamin B Receptor; Anti-Lamin B Receptor; MGC9041; DHCR14B; LBR; PHA; LMN2R
Product Gene Name
anti-LBR antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Specificity
Lamin B Receptor antibody was raised against the middle region of LBR
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LBR antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
The protein encoded by this gene belongs to the ERG4/ERG24 family. It is localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
Immunogen
Lamin B Receptor antibody was raised using the middle region of LBR corresponding to a region with amino acids GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-LBR antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-LBR antibody
Rabbit polyclonal Lamin B Receptor antibody raised against the middle region of LBR
Product Categories/Family for anti-LBR antibody
Cell Biology; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-LBR antibody
Western Blot (WB)
Application Notes for anti-LBR antibody
WB: 1 ug/ml
Western Blot (WB) of anti-LBR antibody
Lamin B Receptor antibody (MBS5302861) used at 1 ug/ml to detect target protein.

NCBI/Uniprot data below describe general gene information for LBR. It may not necessarily be applicable to this product.
NCBI Accession #
AAA59494.1
[Other Products]
UniProt Secondary Accession #
Q14740; Q53GU7; Q59FE6; B2R5P3[Other Products]
UniProt Related Accession #
Q14739[Other Products]
Molecular Weight
71 kDa (MW of target protein)[Similar Products]
NCBI Official Full Name
lamin B receptor
NCBI Official Synonym Full Names
lamin B receptor
NCBI Official Symbol
LBR??[Similar Products]
NCBI Official Synonym Symbols
PHA; LMN2R; TDRD18; DHCR14B
??[Similar Products]
NCBI Protein Information
lamin-B receptor
UniProt Protein Name
Lamin-B receptor
UniProt Synonym Protein Names
Integral nuclear envelope inner membrane protein; LMN2R
Protein Family
Lamin-B receptor
UniProt Gene Name
LBR??[Similar Products]
UniProt Entry Name
LBR_HUMAN
NCBI Summary for LBR
The protein encoded by this gene belongs to the ERG4/ERG24 family. It localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]
UniProt Comments for LBR
LBR: Anchors the lamina and the heterochromatin to the inner nuclear membrane. Defects in LBR are a cause of Pelger-Huet anomaly (PHA). PHA is an autosomal dominant inherited abnormality of neutrophils, characterized by reduced nuclear segmentation and an apparently looser chromatin structure. Heterozygotes show hypolobulated neutrophil nuclei with coarse chromatin. Presumed homozygous individuals have ovoid neutrophil nuclei, as well as varying degrees of developmental delay, epilepsy, and skeletal abnormalities. Defects in LBR are the cause of hydrops-ectopic calcification-moth-eaten skeletal dysplasia (HEM); also known as Greenberg skeletal dysplasia. HEM is a rare autosomal recessive chondrodystrophy characterized by early in utero lethality and, therefore, considered to be nonviable. Affected fetuses typically present with fetal hydrops, short- limbed dwarfism, and a marked disorganization of chondro-osseous calcification and may present with polydactyly and additional nonskeletal malformations. Defects in LBR may be a cause of Reynolds syndrome (REYNS). It is a syndrome specifically associating limited cutaneous systemic sclerosis and primary biliray cirrhosis. It is characterized by liver disease, telangiectasia, abrupt onset of digital paleness or cyanosis in response to cold exposure or stress (Raynaud phenomenon), and variable features of scleroderma. The liver disease is characterized by pruritis, jaundice, hepatomegaly, increased serum alkaline phosphatase and positive serum mitochondrial autoantibodies, all consistent with primary biliary cirrhosis. Belongs to the ERG4/ERG24 family.
Protein type: Membrane protein, multi-pass; Membrane protein, integral; DNA-binding
Chromosomal Location of Human Ortholog: 1q42.1
Cellular Component: nuclear membrane; membrane; integral to membrane; integral to nuclear inner membrane; nuclear envelope
Molecular Function: protein binding; DNA binding; oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor; lamin binding
Biological Process: cholesterol biosynthetic process
Disease: Pelger-huet Anomaly; Greenberg Dysplasia; Reynolds Syndrome
Research Articles on LBR
1. Lamin B receptor mRNA expression was directly associated with tumor grade in breast cancer patients(grade 1 vs. grade 3 - 0.00 vs. 0.00; p = 0.0479) and Nottingham Prognostic Index (NPI1 vs. NPI3 - 0.00 vs. 0.00; p = 0.0551).
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.