Full Product Name
Anti-ABR Antibody
Product Synonym Names
abr; Active BCR related gene; MDB; Q12979; Active breakpoint cluster region-related protein; active BCR-related
Product Gene Name
anti-ABR antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q12979
Species Reactivity
Human, Mouse, Rat
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ABR (370-407aa HPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERL), different from the related mouse sequence by one amino acid.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-ABR antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-ABR antibody
Rabbit IgG polyclonal antibody for Active breakpoint cluster region-related protein (ABR) detection.
Background: This ABR gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene.
Applications Tested/Suitable for anti-ABR antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-ABR antibody
Western Blot: 0.1-0.5mug/ml; Tested Species: Mouse, Rat; Predicted Species: Human
Immunohistochemisry Paraffin: 0.5-1mug/ml; Tested Species: Human, Mouse, Rat
Tested Species:In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Western Blot (WB) of anti-ABR antibody
Western blot analysis of ABR expression in rat brain extract (lane 1) and mouse brain extract (lane 2). ABR at 98KD was detected using rabbit anti- ABR Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Immunohistochemistry (IHC) of anti-ABR antibody
ABR was detected in paraffin-embedded sections of mouse brain tissues using rabbit anti- ABR Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.

Immunohistochemistry (IHC) of anti-ABR antibody
ABR was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ABR Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.

Immunohistochemistry (IHC) of anti-ABR antibody
ABR was detected in paraffin-embedded sections of human mammary cancer tissues using rabbit anti- ABR Antigen Affinity purified polyclonal antibody at 1 ug/mL. The immunohistochemical section was developed using SABC method.

NCBI/Uniprot data below describe general gene information for ABR. It may not necessarily be applicable to this product.
NCBI Accession #
NP_001083.2
[Other Products]
NCBI GenBank Nucleotide #
NM_001092.4
[Other Products]
UniProt Primary Accession #
Q12979
[Other Products]
UniProt Secondary Accession #
Q13693; Q13694; B3KW89; B7Z6H7; D3DTH3; D3DTH4; F5H3S2; F5H8B3[Other Products]
UniProt Related Accession #
Q12979[Other Products]
Molecular Weight
92,425 Da
NCBI Official Full Name
active breakpoint cluster region-related protein isoform b
NCBI Official Synonym Full Names
active BCR-related
NCBI Official Symbol
ABR??[Similar Products]
NCBI Official Synonym Symbols
MDB
??[Similar Products]
NCBI Protein Information
active breakpoint cluster region-related protein
UniProt Protein Name
Active breakpoint cluster region-related protein
UniProt Gene Name
ABR??[Similar Products]
UniProt Entry Name
ABR_HUMAN
NCBI Summary for ABR
This gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene. [provided by RefSeq, Feb 2012]
UniProt Comments for ABR
GTPase-activating protein for RAC and CDC42. Promotes the exchange of RAC or CDC42-bound GDP by GTP, thereby activating them.
Product References and Citations for anti-ABR antibody
1. Heisterkamp, N., Kaartinen, V., van Soest, S., Bokoch, G. M., Groffen, J. Human ABR encodes a protein with GAP-rac activity and homology to the DBL nucleotide exchange factor domain. J. Biol. Chem. 268: 16903-16906, 1993.
2. Heisterkamp, N., Morris, C., Groffen, J. ABR, an active BCR-related gene. Nucleic Acids Res. 17: 8821-8831, 1989.
3. McDonald, J. D., Daneshvar, L., Willert, J. R., Matsumura, K., Waldman, F., Cogen, P. H. Physical mapping of chromosome 17p13.3 in the region of a putative tumor suppressor gene important in medulloblastoma. Genomics 23: 229-232, 1994.
Research Articles on ABR
1. Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.