Full Product Name
ABR Polyclonal Antibody
Product Synonym Names
ABR; MDB; active BCR-related
Product Gene Name
anti-ABR antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q12979
Species Reactivity
Mouse, Rat
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.78 mg/ml (lot specific)
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 200 to the C-terminus of human ABR (NP_001243776.1).
Immunogen Sequence
DPAAKENCMMHLLRSLPDPNLITFLFLLEHLKRVAEKEPINKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQHPPISFAELKRNTLYFSTDV
Positive Samples
Mouse Thymus, Rat Lung, Rat Spleen
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Other Notes
Small volumes of anti-ABR antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-ABR antibody
This gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene.
Applications Tested/Suitable for anti-ABR antibody
Western Blot (WB)
Application Notes for anti-ABR antibody
WB: 1:500-1:2000
Western Blot (WB) of anti-ABR antibody
Western blot-ABR Polyclonal Antibody
NCBI/Uniprot data below describe general gene information for ABR. It may not necessarily be applicable to this product.
NCBI Accession #
NP_001083.2
[Other Products]
NCBI GenBank Nucleotide #
NP_001083.2
[Other Products]
UniProt Primary Accession #
Q12979
[Other Products]
UniProt Related Accession #
Q12979[Other Products]
Molecular Weight
Calculated: 35kDa; 92kDa; 93kDa; 97kDa
Observed: 110kDa
NCBI Official Full Name
active breakpoint cluster region-related protein isoform b
NCBI Official Synonym Full Names
ABR activator of RhoGEF and GTPase
NCBI Official Symbol
ABR??[Similar Products]
NCBI Official Synonym Symbols
MDB
??[Similar Products]
NCBI Protein Information
active breakpoint cluster region-related protein
UniProt Protein Name
Active breakpoint cluster region-related protein
UniProt Gene Name
ABR??[Similar Products]
UniProt Entry Name
ABR_HUMAN
NCBI Summary for ABR
This gene encodes a protein that is similar to the protein encoded by the breakpoint cluster region gene located on chromosome 22. The protein encoded by this gene contains a GTPase-activating protein domain, a domain found in members of the Rho family of GTP-binding proteins. Functional studies in mice determined that this protein plays a role in vestibular morphogenesis. Alternatively spliced transcript variants have been reported for this gene. [provided by RefSeq, Feb 2012]
UniProt Comments for ABR
GTPase-activating protein for RAC and CDC42. Promotes the exchange of RAC or CDC42-bound GDP by GTP, thereby activating them.
Research Articles on ABR
1. ABR depletion leads to G2/M accumulation in human embryonic stem cells. Centrosome dynamics and mitotic fidelity are compromised upon ABR depletion. When mitosis progresses without ABR, human embryonic stem cells show a high incidence of aneuploidy.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
