Full Product Name
Anti-ATP7b Antibody
Product Synonym Names
ATP7B; Copper pump 2; Coppertransporting ATPase 2; Copper-transporting ATPase 2; P35670; PWD; WND; WC1; Wilson disease-associated protein; ATPase, Cu++ transporting, beta polypeptide
Product Gene Name
anti-ATP7B antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for P35670
Species Reactivity
Human, Mouse, Rat
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Notes
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ATP7b (616-652aa RDIIKIIEEIGFHASLAQRNPNAHHLDHKMEIKQWKK), different from the related mouse sequence by one amino acid, and from the related rat sequence by three amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-ATP7B antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-ATP7B antibody
Rabbit IgG polyclonal antibody for Copper-transporting ATPase 2(ATP7B) detection.
Background: ATPase, Cu++ transporting, beta polypeptide (Wilson disease) protein, also called ATP7B, is an ATPase that transports copper. This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least two putative copper-s. ATP7B is mapped to 13q14.3. This protein functions as a monomer, exporting copper out of the cells. When copper levels are in excess, ATP7B redistributes to a vesicular compartment near the biliary canalicular membranes for elimination of excess copper into bile, and it is transported along liver cell microtubules via interaction with the p62 dynactin subunit.
Applications Tested/Suitable for anti-ATP7B antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes for anti-ATP7B antibody
Western Blot: 0.1-0.5ug/ml
Immunohistochemistry(IHC) Paraffin: 0.5-1ug/ml
Western Blot (WB) of anti-ATP7B antibody
Western blot analysis of ATP7b expression in RH35 whole cell lysates (lane 1), HEPA whole cell lysates (lane 2) and HEPG2 whole cell lysates (lane 3). ATP7b at 157KD was detected using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

Immunohistochemistry (IHC) of anti-ATP7B antibody
ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.

Immunohistochemistry (IHC) of anti-ATP7B antibody
ATP7b was detected in paraffin-embedded sections of rat brain tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.

Immunohistochemistry (IHC) of anti-ATP7B antibody
ATP7b was detected in paraffin-embedded sections of human glioma tissues using rabbit anti- ATP7b Antigen Affinity purified polyclonal antibody at 1ug/mL. The immunohistochemical section was developed using SABC method.

NCBI/Uniprot data below describe general gene information for ATP7B. It may not necessarily be applicable to this product.
NCBI Accession #
NP_000044.2
[Other Products]
NCBI GenBank Nucleotide #
NM_000053.3
[Other Products]
UniProt Primary Accession #
P35670
[Other Products]
UniProt Secondary Accession #
Q16318; Q16319; Q4U3V3; Q59FJ9; Q5T7X7[Other Products]
UniProt Related Accession #
P35670[Other Products]
Molecular Weight
155,125 Da
NCBI Official Full Name
copper-transporting ATPase 2 isoform a
NCBI Official Synonym Full Names
ATPase copper transporting beta
NCBI Official Symbol
ATP7B??[Similar Products]
NCBI Official Synonym Symbols
WD; PWD; WC1; WND
??[Similar Products]
NCBI Protein Information
copper-transporting ATPase 2
UniProt Protein Name
Copper-transporting ATPase 2
UniProt Synonym Protein Names
Copper pump 2; Wilson disease-associated protein
UniProt Gene Name
ATP7B??[Similar Products]
UniProt Synonym Gene Names
PWD; WC1; WND??[Similar Products]
NCBI Summary for ATP7B
This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-s. This protein functions as a monomer, exporting copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease (WD). [provided by RefSeq, Jul 2008]
UniProt Comments for ATP7B
ATP7B: Involved in the export of copper out of the cells, such as the efflux of hepatic copper into the bile. Monomer. Interacts with COMMD1/MURR1. Most abundant in liver and kidney and also found in brain. Isoform 2 is expressed in brain but not in liver. The cleaved form WND/140 kDa is found in liver cell lines and other tissues. Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IB subfamily. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: EC 3.6.3.54; Hydrolase; Membrane protein, integral; Membrane protein, multi-pass; Transporter; Transporter, ion channel; Vesicle
Chromosomal Location of Human Ortholog: 13q14.3
Cellular Component: basolateral plasma membrane; cytoplasmic vesicle; Golgi membrane; integral to plasma membrane; late endosome; membrane; perinuclear region of cytoplasm; trans-Golgi network; trans-Golgi network membrane
Molecular Function: ATP binding; copper ion binding; copper ion transmembrane transporter activity; copper-exporting ATPase activity; copper-transporting ATPase activity; protein binding
Biological Process: cellular copper ion homeostasis; copper ion import; copper ion transport; response to copper ion; sequestering of calcium ion
Disease: Wilson Disease
Product References and Citations for anti-ATP7B antibody
1. "Entrez Gene: ATP7B ATPase, Cu++ transporting, beta polypeptide".
2. Lim, C. M., Cater, M. A., Mercer, J. F. B., La Fontaine, S. Copper-dependent interaction of dynactin subunit p62 with the N terminus of ATP7B but not ATP7A. J. Biol. Chem. 281: 14006-14014, 2006.
Research Articles on ATP7B
1. In the group of 75 Wilson Disease patients of Croatian origin, 18 different mutations in ATP7B gene were detected, three of which were novel. The p.His1069Gln mutation was most frequent, being detected in 44 Croatian WD patients (58.7%). Most ATP7B mutations (90.4%) were located in exons 5, 8, 13, 14, and 15.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.