Product Name
Connexin 32/GJB1, Polyclonal Antibody
Full Product Name
Anti-Connexin 32/GJB1 Picoband antibody
Product Synonym Names
Gap junction beta-1 protein; Connexin-32; Cx32; GAP junction 28 kDa liver protein; GJB1; CX32
Product Gene Name
anti-GJB1 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for P08034
Species Reactivity
Mouse, Rat
Predicted Reactivity: Human
No cross reactivity with other proteins.
Immunogen
A synthetic peptide corresponding to a sequence of human Connexin 32/GJB1 (AMHVAHQQHIEKKMLRLEGHGDPLHLEEVKRHKVH).
Subcellular Localization
Cell membrane; Multi-pass membrane protein. Cell junction, gap junction.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-GJB1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-GJB1 antibody
Description: Gap junction beta-1 protein (GJB1), also known as connexin 32 (Cx32) is a transmembrane protein that in humans is encoded by the GJB1 gene. This gene encodes a member of the gap junction protein family. The gap junction proteins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. According to sequence similarities at the nucleotide and amino acid levels, the gap junction proteins are divided into two categories, alpha and beta. Mutations in this gene cause X-linked Charcot-Marie-Tooth disease, an inherited peripheral neuropathy. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
Protein Function: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Applications Tested/Suitable for anti-GJB1 antibody
Western Blot (WB)
Application Notes for anti-GJB1 antibody
WB: 0.1-0.5mug/ml
Western Blot (WB) of anti-GJB1 antibody
Figure 1. Western blot analysis of Connexin 32/GJB1 using anti-Connexin 32/GJB1 antibody (MBS1750553).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: rat kidney tissue lysates,
Lane 2: mouse kidney tissue lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Connexin 32/GJB1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for Connexin 32/GJB1 at approximately 32KD. The expected band size for Connexin 32/GJB1 is at 32KD.

NCBI/Uniprot data below describe general gene information for GJB1. It may not necessarily be applicable to this product.
NCBI Accession #
NP_000157.1
[Other Products]
NCBI GenBank Nucleotide #
NP_000157.1
[Other Products]
UniProt Primary Accession #
P08034
[Other Products]
UniProt Secondary Accession #
Q5U0S4; B2R8R2; D3DVV2[Other Products]
UniProt Related Accession #
P08034[Other Products]
Molecular Weight
32,025 Da
NCBI Official Full Name
gap junction beta-1 protein
NCBI Official Synonym Full Names
gap junction protein beta 1
NCBI Official Symbol
GJB1??[Similar Products]
NCBI Official Synonym Symbols
CMTX; CX32; CMTX1
??[Similar Products]
NCBI Protein Information
gap junction beta-1 protein
UniProt Protein Name
Gap junction beta-1 protein
UniProt Synonym Protein Names
Connexin-32; Cx32; GAP junction 28 kDa liver protein
Protein Family
Gap junction beta-1 protein
UniProt Gene Name
GJB1??[Similar Products]
UniProt Synonym Gene Names
CX32; Cx32??[Similar Products]
NCBI Summary for GJB1
This gene encodes a member of the gap junction protein family. The gap junction proteins are membrane-spanning proteins that assemble to form gap junction channels that facilitate the transfer of ions and small molecules between cells. According to sequence similarities at the nucleotide and amino acid levels, the gap junction proteins are divided into two categories, alpha and beta. Mutations in this gene cause X-linked Charcot-Marie-Tooth disease, an inherited peripheral neuropathy. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Oct 2008]
UniProt Comments for GJB1
One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.
Research Articles on GJB1
1. Study reports mutation frequency of GJB1 in 210 Hungarian Charcot-Marie-Tooth neuropathy (CMT) patients and phenotype comparison between male and female CMT X type 1 patients. 13 missense substitutions were found in GJB1; pathogenic alterations were found mainly in males. Statistical analysis of CMT X type 1 patients revealed a significant difference between genders regarding the age of onset, CMT and examination scores.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.