Product Name
CCDC6, Polyclonal Antibody
Popular Item
Full Product Name
CCDC6 Polyclonal Antibody
Product Synonym Names
CCDC6; D10S170; H4; PTC; TPC; TST1; coiled-coil domain containing 6
Product Gene Name
anti-CCDC6 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q16204
Species Reactivity
Human, Mouse
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.99 mg/ml (lot specific)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 55-222 of human CCDC6 (NP_005427.2).
Immunogen Sequence
RLEELTNRLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMD
Positive Samples
MCF7, HeLa, Jurkat, Mouse Brain
Cellular Location
Cytoplasm, Cytoskeleton
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Other Notes
Small volumes of anti-CCDC6 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-CCDC6 antibody
This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.
Applications Tested/Suitable for anti-CCDC6 antibody
Western Blot (WB)
Application Notes for anti-CCDC6 antibody
WB: 1:500-1:2000
Western Blot (WB) of anti-CCDC6 antibody
Western blot-CCDC6 Polyclonal Antibody

NCBI/Uniprot data below describe general gene information for CCDC6. It may not necessarily be applicable to this product.
NCBI Accession #
NP_005427.2
[Other Products]
NCBI GenBank Nucleotide #
NP_005427.2
[Other Products]
UniProt Primary Accession #
Q16204
[Other Products]
UniProt Related Accession #
Q16204[Other Products]
Molecular Weight
Calculated: 53kDa
Observed: 56kDa
NCBI Official Full Name
coiled-coil domain-containing protein 6
NCBI Official Synonym Full Names
coiled-coil domain containing 6
NCBI Official Symbol
CCDC6??[Similar Products]
NCBI Official Synonym Symbols
H4; PTC; TPC; TST1; D10S170
??[Similar Products]
NCBI Protein Information
coiled-coil domain-containing protein 6
UniProt Protein Name
Coiled-coil domain-containing protein 6
UniProt Synonym Protein Names
Papillary thyroid carcinoma-encoded protein; Protein H4
Protein Family
Coiled-coil domain-containing protein
UniProt Gene Name
CCDC6??[Similar Products]
UniProt Synonym Gene Names
D10S170; TST1??[Similar Products]
NCBI Summary for CCDC6
This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.[provided by RefSeq, Sep 2010]
UniProt Comments for CCDC6
CCDC6: Defects in CCDC6 are a cause of thyroid papillary carcinoma (TPC). TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. A chromosomal aberration involving CCDC6 is found in thyroid papillary carcinomas. Inversion inv(10)(q11.2;q21) generates the RET/CCDC6 (PTC1) oncogene.
Protein type: Apoptosis; Cytoskeletal; Oncoprotein
Chromosomal Location of Human Ortholog: 10q21.2
Cellular Component: cytoplasm
Molecular Function: protein binding; structural constituent of cytoskeleton
Disease: Thyroid Carcinoma, Papillary
Research Articles on CCDC6
1. The identification of two clusters of patients based on CCDC6 and USP7 expession can possibly indicate the use of PARP-inhibitor drugs.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.