Full Product Name
Anti-CCDC6 Antibody
Product Synonym Names
CCDC 6; CCDC6; D10S170; H4; Protein H4; PTC; TPC; TST1; TST 1; Q16204; Coiled-coil domain-containing protein 6
Product Gene Name
anti-CCDC6 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q16204
Species Reactivity
Human, Rat
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human CCDC6 (156-198aa KAELEQHLEQEQEFQVNKLMKKIKKLENDTISKQLTLEQLRR E), identical to the related mouse sequence.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-CCDC6 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-CCDC6 antibody
Rabbit IgG polyclonal antibody for Coiled-coil domain-containing protein 6(CCDC6) detection.
Background: Coiled-coil domain-containing protein 6 is a protein that in humans is encoded by the CCDC6 gene. This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.
Applications Tested/Suitable for anti-CCDC6 antibody
Western Blot (WB)
Application Notes for anti-CCDC6 antibody
Western Blot: 0.1-0.5ug/ml
Western Blot (WB) of anti-CCDC6 antibody
Western blot analysis of CCDC6 expression in rat testis extract (lane 1) and MCF-7 whole cell lysates (lane 2). CCDC6 at 66KD was detected using rabbit anti- CCDC6 Antigen Affinity purified polyclonal antibody at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method.
NCBI/Uniprot data below describe general gene information for CCDC6. It may not necessarily be applicable to this product.
NCBI Accession #
NP_005427.2
[Other Products]
NCBI GenBank Nucleotide #
NM_005436.4
[Other Products]
UniProt Primary Accession #
Q16204
[Other Products]
UniProt Secondary Accession #
Q15250; Q6GSG7[Other Products]
UniProt Related Accession #
Q16204[Other Products]
Molecular Weight
53,291 Da
NCBI Official Full Name
coiled-coil domain-containing protein 6
NCBI Official Synonym Full Names
coiled-coil domain containing 6
NCBI Official Symbol
CCDC6??[Similar Products]
NCBI Official Synonym Symbols
H4; PTC; TPC; TST1; D10S170
??[Similar Products]
NCBI Protein Information
coiled-coil domain-containing protein 6
UniProt Protein Name
Coiled-coil domain-containing protein 6
UniProt Synonym Protein Names
Papillary thyroid carcinoma-encoded protein; Protein H4
Protein Family
Coiled-coil domain-containing protein
UniProt Gene Name
CCDC6??[Similar Products]
UniProt Synonym Gene Names
D10S170; TST1??[Similar Products]
NCBI Summary for CCDC6
This gene encodes a coiled-coil domain-containing protein. The encoded protein is ubiquitously expressed and may function as a tumor suppressor. A chromosomal rearrangement resulting in the expression of a fusion gene containing a portion of this gene and the intracellular kinase-encoding domain of the ret proto-oncogene is the cause of thyroid papillary carcinoma.[provided by RefSeq, Sep 2010]
UniProt Comments for CCDC6
CCDC6: Defects in CCDC6 are a cause of thyroid papillary carcinoma (TPC). TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. A chromosomal aberration involving CCDC6 is found in thyroid papillary carcinomas. Inversion inv(10)(q11.2;q21) generates the RET/CCDC6 (PTC1) oncogene.
Protein type: Apoptosis; Cytoskeletal; Oncoprotein
Chromosomal Location of Human Ortholog: 10q21.2
Cellular Component: cytoplasm
Molecular Function: protein binding; structural constituent of cytoskeleton
Disease: Thyroid Carcinoma, Papillary
Product References and Citations for anti-CCDC6 antibody
1. Anne-Spence M, Falk CT, Neiswanger K, Field LL, Marazita ML, Allen FH, Siervogel RM, Roche AF, Crandall BF, Sparkes RS (Sep 1984). "Estimating the recombination frequency for the PTC-Kell linkage". Human Genetics 67(2): 183-6.
2. Grieco M, Cerrato A, Santoro M, Fusco A, Melillo RM, Vecchio G (Sep 1994). "Cloning and characterization of H4 (D10S170), a gene involved in RET rearrangements in vivo". Oncogene 9 (9): 2531-5.
Research Articles on CCDC6
1. Our findings nevertheless suggest that CCDC6-RET fusions identified by multiplex testing are potential targets for nintedanib therapy.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
