Full Product Name
Anti-AFF4 Antibody
Product Synonym Names
AF5Q31; Alf4; CHOPS; HSPC092; Laf4; MCEF; Q9UHB7; AF4/FMR2 family member 4
Product Gene Name
anti-AFF4 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q9UHB7
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human AFF4 (6-53aa RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ), identical to the related mouse sequence.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-AFF4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-AFF4 antibody
Rabbit IgG polyclonal antibody for AF4/FMR2 family member 4(AFF4) detection.
Background: The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.
Applications Tested/Suitable for anti-AFF4 antibody
Western Blot (WB)
Application Notes for anti-AFF4 antibody
Western Blot: 0.1-0.5ug/ml
Western Blot (WB) of anti-AFF4 antibody
Western blot analysis of AFF44 expression in COLO320 whole cell lysates (lane 1). AFF44 at 127KD was detected using rabbit anti- AFF44 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method.

NCBI/Uniprot data below describe general gene information for AFF4. It may not necessarily be applicable to this product.
NCBI Accession #
NP_055238.1
[Other Products]
NCBI GenBank Nucleotide #
NM_014423.3
[Other Products]
UniProt Primary Accession #
Q9UHB7
[Other Products]
UniProt Secondary Accession #
Q498B2; Q59FB3; Q6P592; Q8TDR1; Q9P0E4; B2RP19; B7WPD2[Other Products]
UniProt Related Accession #
Q9UHB7[Other Products]
Molecular Weight
38,823 Da
NCBI Official Full Name
AF4/FMR2 family member 4
NCBI Official Synonym Full Names
AF4/FMR2 family member 4
NCBI Official Symbol
AFF4??[Similar Products]
NCBI Official Synonym Symbols
MCEF; CHOPS; AF5Q31
??[Similar Products]
NCBI Protein Information
AF4/FMR2 family member 4
UniProt Protein Name
AF4/FMR2 family member 4
UniProt Synonym Protein Names
ALL1-fused gene from chromosome 5q31 protein; Protein AF-5q31; Major CDK9 elongation factor-associated protein
Protein Family
AF4/FMR2 family
UniProt Gene Name
AFF4??[Similar Products]
UniProt Synonym Gene Names
AF5Q31; MCEF; Protein AF-5q31??[Similar Products]
NCBI Summary for AFF4
The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. A chromosomal translocation involving this gene and MLL gene on chromosome 11 is found in infant acute lymphoblastic leukemia with ins(5;11)(q31;q31q23). [provided by RefSeq, Oct 2011]
UniProt Comments for AFF4
MCEF: a putative transcription factor. Component of the cyclin-dependent kinase pair (CDK9/cyclin-T1) complex, also called positive transcription elongation factor b (P-TEFb). Genetic fusion of its gene with MLL has been observed in a subset of acute lymphoblastic leukemia patients. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Oncoprotein; Transcription factor
Chromosomal Location of Human Ortholog: 5q31.1
Cellular Component: transcription elongation factor complex
Molecular Function: protein binding; transcription factor activity
Biological Process: transcription from RNA polymerase II promoter
Disease: Chops Syndrome
Product References and Citations for anti-AFF4 antibody
1. Izumi, K., Nakato, R., Zhang, Z., Edmondson, A. C., Noon, S., Dulik, M. C., Rajagopalan, R., Venditti, C. P., Gripp, K., Samanich, J., Zackai, E. H., Deardorff, M. A., and 10 others. Germline gain-of-function mutations in AFF4 cause a developmental syndrome functionally linking the super elongation complex and cohesin. Nature Genet. 47: 338-344, 2015.
2. Taki, T., Kano, H., Taniwaki, M., Sako, M., Yanagisawa, M., Hayashi, Y. AF5q31, a newly identified AF4-related gene, is fused to MLL in infant acute lymphoblastic leukemia with ins(5;11)(q31;q31q23). Proc. Nat. Acad. Sci. 96: 14535-14540, 1999.
Research Articles on AFF4
1. AFF4 is positioned to make unexpected direct contacts with HIV Tat, and Tat enhances P-TEFb/CCNT1 affinity for AFF4.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.