Product Name
Astrotactin 2 (ASTN2), Polyclonal Antibody
Full Product Name
Astrotactin 2 antibody
Product Synonym Names
Polyclonal Astrotactin 2; Anti-Astrotactin 2; KIAA0634; Astrotactin -2; Astrotactin 2; ASTN2; bA67K19.1
Product Gene Name
anti-ASTN2 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Species Reactivity
Human, Mouse
Specificity
Astrotactin 2 antibody was raised against the N terminal of ASTN2
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ASTN2 antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
ASTN2 may play an important role in neuronal functioning.
Immunogen
Astrotactin 2 antibody was raised using the N terminal of ASTN2 corresponding to a region with amino acids ?PGSAGTAAESRLLLFVRNELPGRIAVQDDLDNTELPFFTLEMSGTAADIS
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-ASTN2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-ASTN2 antibody
Rabbit polyclonal Astrotactin 2 antibody raised against the N terminal of ASTN2
Product Categories/Family for anti-ASTN2 antibody
Neuroscience; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-ASTN2 antibody
Western Blot (WB)
Application Notes for anti-ASTN2 antibody
WB: 1 ug/ml
Western Blot (WB) of anti-ASTN2 antibody
Astrotactin 2 antibody (MBS5301419) used at 1 ug/ml to detect target protein.
NCBI/Uniprot data below describe general gene information for ASTN2. It may not necessarily be applicable to this product.
NCBI Accession #
AAH93835.2
[Other Products]
UniProt Secondary Accession #
Q52LQ2; Q5JVX8; Q5JVX9; Q5JVY1; Q5VXG8; Q5VZX6; Q8N6P8; Q8WV47; Q96FL4; A2A2T7; A2A2T9[Other Products]
UniProt Related Accession #
O75129[Other Products]
Molecular Weight
142 kDa (MW of target protein)[Similar Products]
NCBI Official Full Name
Astrotactin 2
NCBI Official Synonym Full Names
astrotactin 2
NCBI Official Symbol
ASTN2??[Similar Products]
NCBI Official Synonym Symbols
bA67K19.1
??[Similar Products]
NCBI Protein Information
astrotactin-2
UniProt Protein Name
Astrotactin-2
Protein Family
Astrotactin
UniProt Gene Name
ASTN2??[Similar Products]
UniProt Synonym Gene Names
KIAA0634??[Similar Products]
UniProt Entry Name
ASTN2_HUMAN
NCBI Summary for ASTN2
This gene encodes a protein that is expressed in the brain and may function in neuronal migration, based on functional studies of the related astrotactin 1 gene in human and mouse. A deletion at this locus has been associated with schizophrenia. Multiple transcript variants encoding different proteins have been found for this locus. [provided by RefSeq, May 2010]
UniProt Comments for ASTN2
ASTN2: a protein that is expressed in the brain and may function in neuronal migration, based on functional studies of the related astrotactin 1 gene in human and mouse. A deletion at this locus has been associated with schizophrenia. Multiple transcript variants encoding different proteins have been found for this locus. [provided by RefSeq, May 2010]
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 9q33.1
Cellular Component: integral to membrane; endosome
Research Articles on ASTN2
1. 3' terminal ASTN2 deletions are significantly enriched in males with neurodevelopmental disorders, but not in females.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
