Product Name
SLC22A11, Polyclonal Antibody
Full Product Name
SLC22A11 antibody
Product Synonym Names
Polyclonal SLC22A11; Anti-SLC22A11; OAT4; SLCA11-22; MGC34282; SLCA11 22; Solute Carrier Family 22 Member 11; hOAT4; Organic Anion/Urate Transporter 11; SLC22A11
Product Gene Name
anti-SLC22A11 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Purity/Purification
Total IgG Protein A purified
Form/Format
Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of SLC22A11 antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
SLC22A11 is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. SLC22A11 is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus.
Immunogen
SLC22A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCW
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-SLC22A11 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-SLC22A11 antibody
Rabbit polyclonal SLC22A11 antibody
Product Categories/Family for anti-SLC22A11 antibody
Cell Biology; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-SLC22A11 antibody
Western Blot (WB)
Application Notes for anti-SLC22A11 antibody
WB: 1.25 ug/ml
Western Blot (WB) of anti-SLC22A11 antibody
SLC22A11 antibody (MBS5300697) used at 1.25 ug/ml to detect target protein.
NCBI/Uniprot data below describe general gene information for SLC22A11. It may not necessarily be applicable to this product.
NCBI Accession #
NP_001294914.1
[Other Products]
NCBI GenBank Nucleotide #
NM_001307985.1
[Other Products]
UniProt Secondary Accession #
Q53GR2; Q6ZP72; Q8NBU4; A8K426[Other Products]
UniProt Related Accession #
Q9NSA0[Other Products]
Molecular Weight
60 kDa (MW of target protein)
NCBI Official Full Name
solute carrier family 22 member 11 isoform 2
NCBI Official Synonym Full Names
solute carrier family 22 (organic anion/urate transporter), member 11
NCBI Official Symbol
SLC22A11??[Similar Products]
NCBI Official Synonym Symbols
OAT4; hOAT4
??[Similar Products]
NCBI Protein Information
solute carrier family 22 member 11
UniProt Protein Name
Solute carrier family 22 member 11
UniProt Synonym Protein Names
Organic anion transporter 4
Protein Family
Solute carrier family
UniProt Gene Name
SLC22A11??[Similar Products]
UniProt Synonym Gene Names
OAT4??[Similar Products]
UniProt Entry Name
S22AB_HUMAN
NCBI Summary for SLC22A11
The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and is found mainly in the kidney and in the placenta, where it may act to prevent potentially harmful organic anions from reaching the fetus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]
UniProt Comments for SLC22A11
SLC22A11: Mediates saturable uptake of estrone sulfate, dehydroepiandrosterone sulfate and related compounds. Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Cell surface; Membrane protein, integral; Transporter; Membrane protein, multi-pass; Transporter, SLC family
Chromosomal Location of Human Ortholog: 11q13.1
Cellular Component: integral to plasma membrane; apical plasma membrane; plasma membrane; external side of plasma membrane
Molecular Function: protein binding; inorganic anion exchanger activity; organic anion transmembrane transporter activity; sodium-independent organic anion transmembrane transporter activity
Biological Process: urate metabolic process; transmembrane transport; organic anion transport
Research Articles on SLC22A11
1. A common variant of OAT4/SLC22A11 is associated with renal underexcretion type gout in Japanese men.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.
