Product Name
ACTH (POMC), Polyclonal Antibody
Full Product Name
Anti-ACTH Antibody
Product Synonym Names
Pro-opiomelanocortin; proopiomelanocortin; ACTH antibody; Adrenocorticotropic hormone antibody; Adrenocorticotropin antibody; Adrenocorticotropin Hormone antibody; Alpha Melanocyte Stimulating Hormone antibody; alpha-MSH antibody; alphaMSH antibody; Beta Endorphin antibody; Beta Lipotropin antibody; Beta LPH antibody; Beta Melanocyte Stimulating Hormone antibody; Beta-endorphin antibody; beta-MSH antibody; CLIP antibody; Corticotropin antibody; Corticotropin Like Intermediary Peptide antibody; Corticotropin lipotropin antibody; Corticotropin lipotropin precursor antibody; Corticotropin-like intermediary peptide antibody; Gamma LPH antibody; gamma-MSH antibody; Lipotropin Beta antibody; Lipotropin Gamma antibody; Lipotropin, included antibody; LPH antibody; Melanocyte-stimulating hormone, included antibody; Melanotropin Alpha antibody; Melanotropin beta antibody; Melanotropin gamma antibody; Melanotropin, included antibody; Met Enkephalin antibody; Met-enkephalin antibody; MSH antibody; NPP antibody; Opiomelanocortin prepropeptide antibody; POC antibody; POMC antibody; Pomc-1 antibody; Pomc1 antibody; Pomc2 antibody; Pro ACTH endorphin antibody; Pro opiomelanocortin antibody; Pro-opiomelanocortin-alpha antibody; Proopiomelanocortin antibody; Proopiomelanocortin preproprotein antibody; Tetracosactide antibody
Product Gene Name
anti-POMC antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for P01189
Species Reactivity
Human, Mouse, Rat
Purity/Purification
Immunogen affinity purified.
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ACTH (138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-POMC antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-POMC antibody
Description: Rabbit IgG polyclonal antibody for Pro-opiomelanocortin(POMC) detection. Tested with IHC-P in Human, Mouse, Rat.
Background: Adrenocorticotropic hormone (ACTH), also known as corticotropin, is a polypeptide tropic hormone produced and secreted by the anterior pituitary gland. It is an important component of the hypothalamic-pituitary-adrenal axis and is often produced in response to
biological stress (along with its precursor corticotropin-releasing hormone from the hypothalamus). Its principal effects are increased production and release of corticosteroids. ACTH stimulates secretion of glucocorticoid steroid hormones from adrenal cortex cells, especially in the zona fasciculata of the adrenal glands. This gene can influence steroid hormone secretion by both rapid short-term mechanisms that take place within minutes and slower long-term actions. Besides, ACTH also enhances transcription of mitochondrial genes that encode for subunits of mitochondrial oxidative phosphorylation systems.
Applications Tested/Suitable for anti-POMC antibody
Immunohistochemistry (IHC) Paraffin
Immunohistochemistry (IHC) of anti-POMC antibody
Anti-ACTH Picoband antibody, MBS176775-1.JPG
IHC(P): Mouse Kidney Tissue

Immunohistochemistry (IHC) of anti-POMC antibody
Anti-ACTH Picoband antibody, MBS176775-2.JPG
IHC(P): Rat Brain Tissue

Immunohistochemistry (IHC) of anti-POMC antibody
Anti-ACTH Picoband antibody, MBS176775-3.JPG
IHC(P): Rat Kidney Tissue

NCBI/Uniprot data below describe general gene information for POMC. It may not necessarily be applicable to this product.
NCBI Accession #
P01189.2
[Other Products]
UniProt Primary Accession #
P01189
[Other Products]
UniProt Secondary Accession #
P78442; Q53T23; Q9UD39; Q9UD40[Other Products]
UniProt Related Accession #
P01189[Other Products]
Molecular Weight
29,424 Da
NCBI Official Full Name
Pro-opiomelanocortin
NCBI Official Synonym Full Names
proopiomelanocortin
NCBI Official Symbol
POMC??[Similar Products]
NCBI Official Synonym Symbols
LPH; MSH; NPP; POC; ACTH; CLIP
??[Similar Products]
NCBI Protein Information
pro-opiomelanocortin; beta-LPH; beta-MSH; alpha-MSH; gamma-LPH; gamma-MSH; beta-endorphin; met-enkephalin; lipotropin beta; lipotropin gamma; melanotropin beta; melanotropin alpha; melanotropin gamma; pro-ACTH-endorphin; adrenocorticotropin; corticotropin-lipotropin; adrenocorticotropic hormone; opiomelanocortin prepropeptide; proopiomelanocortin preproprotein; beta-melanocyte-stimulating hormone; alpha-melanocyte-stimulating hormone; corticotropin-like intermediary peptide
UniProt Protein Name
Pro-opiomelanocortin
UniProt Synonym Protein Names
Corticotropin-lipotropinCleaved into the following 11 chains:NPP; Melanotropin gammaAlternative name(s):Gamma-MSH
Protein Family
Corticotropin
UniProt Gene Name
POMC??[Similar Products]
UniProt Synonym Gene Names
POMC; ACTH; CLIP??[Similar Products]
UniProt Entry Name
COLI_HUMAN
NCBI Summary for POMC
This gene encodes a polypeptide hormone precursor that undergoes extensive, tissue-specific, post-translational processing via cleavage by subtilisin-like enzymes known as prohormone convertases. There are eight potential cleavage sites within the polypeptide precursor and, depending on tissue type and the available convertases, processing may yield as many as ten biologically active peptides involved in diverse cellular functions. The encoded protein is synthesized mainly in corticotroph cells of the anterior pituitary where four cleavage sites are used; adrenocorticotrophin, essential for normal steroidogenesis and the maintenance of normal adrenal weight, and lipotropin beta are the major end products. In other tissues, including the hypothalamus, placenta, and epithelium, all cleavage sites may be used, giving rise to peptides with roles in pain and energy homeostasis, melanocyte stimulation, and immune modulation. These include several distinct melanotropins, lipotropins, and endorphins that are contained within the adrenocorticotrophin and beta-lipotropin peptides. Mutations in this gene have been associated with early onset obesity, adrenal insufficiency, and red hair pigmentation. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008]
UniProt Comments for POMC
POMC: ACTH stimulates the adrenal glands to release cortisol. Defects in POMC may be associated with susceptibility to obesity (OBESITY). It is a condition characterized by an increase of body weight beyond the limitation of skeletal and physical requirements, as the result of excessive accumulation of body fat. Defects in POMC are the cause of pro-opiomelanocortinin deficiency (POMCD). Affected individuals present early-onset obesity, adrenal insufficiency and red hair. Belongs to the POMC family.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 2p23.3
Cellular Component: extracellular space; peroxisomal matrix; cytoplasm; extracellular region; peroxisome; secretory granule
Molecular Function: type 3 melanocortin receptor binding; G-protein-coupled receptor binding; type 4 melanocortin receptor binding; hormone activity; receptor binding
Biological Process: generation of precursor metabolites and energy; cellular protein metabolic process; cell-cell signaling; neuropeptide signaling pathway; regulation of blood pressure; peptide hormone processing; regulation of appetite; positive regulation of transcription from RNA polymerase II promoter; negative regulation of tumor necrosis factor production; glucose homeostasis; signal transduction; cellular pigmentation
Disease: Obesity; Proopiomelanocortin Deficiency
Research Articles on POMC
1. Leukocyte methylation levels reflect a putative epigenetic regulation of NPY and POMC, which might be implicated in weight regain in obese men.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.