Product Name
Mucolipin 1 (MCOLN1), Polyclonal Antibody
Full Product Name
Mucolipin 1 antibody
Product Synonym Names
Polyclonal Mucolipin 1; Anti-Mucolipin 1; Mucolipin 1; Mucolipin -1; MCOLN1
Product Gene Name
anti-MCOLN1 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Species Reactivity
Human, Dog
Specificity
Mucolipin 1 antibody was raised against the N terminal of MCOLN1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of MCOLN1 antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
MCOLN1 encodes a protein that may be involved in calcium signaling and membrane trafficking in mucolipidosis IV.
Immunogen
Mucolipin 1 antibody was raised using the N terminal of MCOLN1 corresponding to a region with amino acids FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-MCOLN1 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-MCOLN1 antibody
Rabbit polyclonal Mucolipin 1 antibody raised against the N terminal of MCOLN1
Product Categories/Family for anti-MCOLN1 antibody
Signal Transduction; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-MCOLN1 antibody
Western Blot (WB)
Application Notes for anti-MCOLN1 antibody
WB: 0.5 ug/ml
Western Blot (WB) of anti-MCOLN1 antibody
Mucolipin 1 antibody (MBS5302916) used at 0.5 ug/ml to detect target protein.

NCBI/Uniprot data below describe general gene information for MCOLN1. It may not necessarily be applicable to this product.
NCBI Accession #
AAG42242.1
[Other Products]
UniProt Secondary Accession #
Q7Z4F7; Q9H292; Q9H4B3; Q9H4B5; D6W647[Other Products]
UniProt Related Accession #
Q9GZU1[Other Products]
Molecular Weight
64 kDa (MW of target protein)[Similar Products]
NCBI Official Full Name
mucolipin 1
NCBI Official Synonym Full Names
mucolipin 1
NCBI Official Symbol
MCOLN1??[Similar Products]
NCBI Official Synonym Symbols
ML4; MG-2; MLIV; MST080; TRPML1; MSTP080; TRP-ML1; TRPM-L1
??[Similar Products]
NCBI Protein Information
mucolipin-1
UniProt Protein Name
Mucolipin-1
UniProt Synonym Protein Names
MG-2; Mucolipidin
UniProt Gene Name
MCOLN1??[Similar Products]
UniProt Synonym Gene Names
ML4??[Similar Products]
UniProt Entry Name
MCLN1_HUMAN
NCBI Summary for MCOLN1
This gene encodes a memberof the transient receptor potential (TRP) cation channel gene family. The transmembrane protein localizes to intracellular vesicular membranes including lysosomes, and functions in the late endocytic pathway and in the regulation of lysosomal exocytosis. The channel is permeable to Ca(2+), Fe(2+), Na(+), K(+), and H(+), and is modulated by changes in Ca(2+) concentration. Mutations in this gene result in mucolipidosis type IV. [provided by RefSeq, Oct 2009]
UniProt Comments for MCOLN1
mucolipin 1: Cation channel probably playing a role in the endocytic pathway and in the control of membrane trafficking of proteins and lipids. Could play a major role in Ca(2+) transport regulating lysosomal exocytosis. Defects in MCOLN1 are the cause of mucolipidosis type IV (MLIV); also known as sialolipidosis. MLIV is an autosomal recessive lysosomal storage disorder characterized by severe psychomotor retardation and ophthalmologic abnormalities, including corneal opacity, retinal degeneration and strabismus. Storage bodies of lipids and water-soluble substances are seen by electron microscopy in almost every cell type of the patients. Most patients are unable to speak or walk independently and reach a maximal developmental level of 1-2 years. All patients have constitutive achlorhydia associated with a secondary elevation of serum gastrin levels. MLIV may be due to a defect in sorting and/or transport along the late endocytic pathway. MLIV is found at relatively high frequency among Ashkenazi Jews. Belongs to the transient receptor (TC 1.A.4) family. Polycystin subfamily. MCOLN1 sub-subfamily.
Protein type: Membrane protein, multi-pass; Membrane protein, integral; Channel, cation; Transporter, ion channel
Chromosomal Location of Human Ortholog: 19p13.2
Cellular Component: late endosome membrane; integral to plasma membrane; lysosomal membrane; cytoplasm; integral to membrane; plasma membrane; endosome membrane; receptor complex
Molecular Function: cation channel activity
Biological Process: cellular iron ion homeostasis; release of sequestered calcium ion into cytosol; transferrin transport; transmembrane transport; cation transport
Disease: Mucolipidosis Iv
Research Articles on MCOLN1
1. lysosomal adaptation to environmental cues such as nutrient levels requires mTOR/TFEB-dependent, lysosome-to-nucleus regulation of lysosomal ML1 channels and Ca(2+) signaling.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.