Product Name
AS3MT, Polyclonal Antibody
Popular Item
Full Product Name
AS3MT Polyclonal Antibody
Product Synonym Names
AS3MT; CYT19; arsenite methyltransferase
Product Gene Name
anti-AS3MT antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q9HBK9
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
4 mg/ml (lot specific)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 216-375 of human AS3MT (NP_065733.2).
Immunogen Sequence
LAVLAQKIGFCPPRLVTANLITIQNKELERVIGDCRFVSATFRLFKHSKTGPTKRCQVIYNGGITGHEKELMFDANFTFKEGEIVEVDEETAAILKNSRFAQDFLIRPIGEKLPTSGGCSALELKDIITDPFKLAEESDSMKSRCVPDAAGGCCGTKKSC
Positive Samples
Mouse Spleen
Cellular Location
Cytoplasm
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Other Notes
Small volumes of anti-AS3MT antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-AS3MT antibody
AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism.
Applications Tested/Suitable for anti-AS3MT antibody
Western Blot (WB)
Application Notes for anti-AS3MT antibody
WB: 1:500-1:2000
Western Blot (WB) of anti-AS3MT antibody
Western blot-AS3MT Polyclonal Antibody

NCBI/Uniprot data below describe general gene information for AS3MT. It may not necessarily be applicable to this product.
NCBI Accession #
NP_065733.2
[Other Products]
NCBI GenBank Nucleotide #
NP_065733.2
[Other Products]
UniProt Primary Accession #
Q9HBK9
[Other Products]
UniProt Related Accession #
Q9HBK9[Other Products]
Molecular Weight
Calculated: 31kDa; 41kDa
Observed: 42kDa
NCBI Official Full Name
arsenite methyltransferase
NCBI Official Synonym Full Names
arsenite methyltransferase
NCBI Official Symbol
AS3MT??[Similar Products]
NCBI Official Synonym Symbols
CYT19
??[Similar Products]
NCBI Protein Information
arsenite methyltransferase
UniProt Protein Name
Arsenite methyltransferase
UniProt Synonym Protein Names
Methylarsonite methyltransferase; S-adenosyl-L-methionine:arsenic(III) methyltransferase
Protein Family
Arsenite methyltransferase
UniProt Gene Name
AS3MT??[Similar Products]
UniProt Synonym Gene Names
CYT19??[Similar Products]
UniProt Entry Name
AS3MT_HUMAN
NCBI Summary for AS3MT
AS3MT catalyzes the transfer of a methyl group from S-adenosyl-L-methionine (AdoMet) to trivalent arsenical and may play a role in arsenic metabolism (Lin et al., 2002 [PubMed 11790780]).[supplied by OMIM, Mar 2008]
UniProt Comments for AS3MT
AS3MT: Catalyzes the transfer of a methyl group from AdoMet to trivalent arsenicals producing methylated and dimethylated arsenicals. It methylates arsenite to form methylarsonate, Me- AsO(3)H(2), which is reduced by methylarsonate reductase to methylarsonite, Me-As(OH)2. Methylarsonite is also a substrate and it is converted into the much less toxic compound dimethylarsinate (cacodylate), Me(2)As(O)-OH. Belongs to the methyltransferase superfamily.
Protein type: Methyltransferase; Mitochondrial; EC 2.1.1.137
Chromosomal Location of Human Ortholog: 10q24.32
Cellular Component: mitochondrion; cytoplasm; cytosol
Molecular Function: arsenite methyltransferase activity; methylarsonite methyltransferase activity; S-adenosylmethionine-dependent methyltransferase activity
Biological Process: methylation; arsonoacetate metabolic process; toxin metabolic process
Research Articles on AS3MT
1. The median concentration of arsenic in water was 82 mug/L; the levels of urinary excretion of dimethylarsinic acid (DMA) were higher in women than in the men. The carriers of the CC genetic variant of the As3MT (rs3740393) gene showed higher urinary concentrations of methylarsinic acid (p=0.01) and DMA (p=0.05)
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.