Product Name
SLC27A4, Polyclonal Antibody
Full Product Name
SLC27A4 antibody
Product Synonym Names
Polyclonal SLC27A4; Anti-SLC27A4; ACSVL4; Solute Carrier Family 27 Member 4; SLCA4 27; SLC27A4; SLCA4-27; FATP4; Fatty Acid Transporter 4
Product Gene Name
anti-SLC27A4 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SLC27A4 antibody in PBS
Concentration
1 mg/ml (lot specific)
Biological Significance
SLC27A4 is involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. It appears to be the principal fatty acid transporter in small intestinal enterocytes. SLC27A4 plays a role in the formation of the epidermal barrier. It is required for fat absorption in early embryogenesis. SLC27A4 has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.
Immunogen
SLC27A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Other Notes
Small volumes of anti-SLC27A4 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-SLC27A4 antibody
Rabbit polyclonal SLC27A4 antibody
Product Categories/Family for anti-SLC27A4 antibody
Cell Biology; Purified Polyclonal Antibodies
Applications Tested/Suitable for anti-SLC27A4 antibody
Western Blot (WB)
Application Notes for anti-SLC27A4 antibody
WB: 1 ug/ml
Western Blot (WB) of anti-SLC27A4 antibody
SLC27A4 antibody (MBS5301586) used at 1 ug/ml to detect target protein.

NCBI/Uniprot data below describe general gene information for SLC27A4. It may not necessarily be applicable to this product.
NCBI Accession #
AAH09959.1
[Other Products]
UniProt Secondary Accession #
O95186; Q96G53; A8K2F7[Other Products]
UniProt Related Accession #
Q6P1M0[Other Products]
Molecular Weight
72 kDa (MW of target protein)
NCBI Official Full Name
SLC27A4 protein
NCBI Official Synonym Full Names
solute carrier family 27 (fatty acid transporter), member 4
NCBI Official Symbol
SLC27A4??[Similar Products]
NCBI Official Synonym Symbols
IPS; FATP4; ACSVL4
??[Similar Products]
NCBI Protein Information
long-chain fatty acid transport protein 4
UniProt Protein Name
Long-chain fatty acid transport protein 4
UniProt Synonym Protein Names
Solute carrier family 27 member 4
Protein Family
Long-chain fatty acid transport protein
UniProt Gene Name
SLC27A4??[Similar Products]
UniProt Synonym Gene Names
ACSVL4; FATP4; FATP-4; Fatty acid transport protein 4??[Similar Products]
UniProt Entry Name
S27A4_HUMAN
NCBI Summary for SLC27A4
This gene encodes a member of a family of fatty acid transport proteins, which are involved in translocation of long-chain fatty acids cross the plasma membrane. This protein is expressed at high levels on the apical side of mature enterocytes in the small intestine, and appears to be the principal fatty acid transporter in enterocytes. Clinical studies suggest this gene as a candidate gene for the insulin resistance syndrome. Mutations in this gene have been associated with ichthyosis prematurity syndrome. [provided by RefSeq, Apr 2010]
UniProt Comments for SLC27A4
SLC27A4: Involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. Appears to be the principal fatty acid transporter in small intestinal enterocytes. Plays a role in the formation of the epidermal barrier. Required for fat absorption in early embryogenesis. Has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids. Defects in SLC27A4 are the cause of ichthyosis prematurity syndrome (IPS). A keratinization disorder characterized by complications in the second trimester of pregnancy resulting from polyhydramnion, with premature birth of a child with thick caseous desquamating epidermis, respiratory complications and transient eosinophilia. After recovery during the first months of life, the symptoms are relatively benign and the patients suffer from a lifelong non-scaly ichthyosis with atopic manifestations. Belongs to the ATP-dependent AMP-binding enzyme family.
Protein type: Transporter, SLC family; Ligase; Membrane protein, multi-pass; Membrane protein, integral; EC 6.2.1.-; Transporter
Chromosomal Location of Human Ortholog: 9q34.11
Cellular Component: endoplasmic reticulum membrane; microvillus; membrane; brush border membrane; integral to membrane; plasma membrane
Molecular Function: fatty acid transporter activity; nucleotide binding; very-long-chain-fatty-acid-CoA ligase activity; long-chain-fatty-acid-CoA ligase activity
Biological Process: long-chain fatty acid transport; skin development; transport; very-long-chain fatty acid catabolic process; lipid metabolic process; long-chain fatty acid metabolic process; medium-chain fatty acid transport; transmembrane transport; response to nutrient; fatty acid transport
Disease: Ichthyosis Prematurity Syndrome
Research Articles on SLC27A4
1. A) that is predicted to lead to a p.Val477Asp substitution in fatty acid transport protein 4.">We describe two siblings with ichthyosis prematurity syndrome and report a recurrent homozygous mutation (c.1430T>A) that is predicted to lead to a p.Val477Asp substitution in fatty acid transport protein 4.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.