Product Name
SLC4A11, Polyclonal Antibody
Popular Item
Full Product Name
SLC4A11 Polyclonal Antibody
Product Synonym Names
SLC4A11; BTR1; CDPD1; CHED; CHED2; NABC1; dJ794I6.2; solute carrier family 4 member 11
Product Gene Name
anti-SLC4A11 antibody
[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
3D Structure
ModBase 3D Structure for Q8NBS3
Species Reactivity
Human, Mouse
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.59 mg/ml (lot specific)
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human SLC4A11 (NP_114423.1).
Immunogen Sequence
MSQVGGRGDRCTQEVQGLVHGAGDLSASLAENSPTMSQNGYFEDSSYYKCDTDDTFEAREEILGDEAFDTANSSIVSGESIRFFVNVNLEMQATNTENEATSGGCVLLHTSRKYLKLKNFKEEIRAHRDLDGFLAQASIVLNETATSLDNVLRTMLRRFARDPDNNEPNCNLDLLMAMLF
Positive Samples
293T, Mouse Kidney
Cellular Location
Cell Membrane, Membrane, Multi-Pass Membrane Protein
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.
Other Notes
Small volumes of anti-SLC4A11 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-SLC4A11 antibody
This gene encodes a voltage-regulated, electrogenic sodium-coupled borate cotransporter that is essential for borate homeostasis, cell growth and cell proliferation. Mutations in this gene have been associated with a number of endothelial corneal dystrophies including recessive corneal endothelial dystrophy 2, corneal dystrophy and perceptive deafness, and Fuchs endothelial corneal dystrophy. Multiple transcript variants encoding different isoforms have been described.
Applications Tested/Suitable for anti-SLC4A11 antibody
Western Blot (WB)
Application Notes for anti-SLC4A11 antibody
WB: 1:500-1:2000
Western Blot (WB) of anti-SLC4A11 antibody
Western blot-SLC4A11 Polyclonal Antibody

NCBI/Uniprot data below describe general gene information for SLC4A11. It may not necessarily be applicable to this product.
NCBI Accession #
NP_001167560.1
[Other Products]
NCBI GenBank Nucleotide #
NP_001167560.1
[Other Products]
UniProt Primary Accession #
Q8NBS3
[Other Products]
UniProt Related Accession #
Q8NBS3[Other Products]
Molecular Weight
Calculated: 45kDa; 98kDa; 99kDa; 103kDa
Observed: 100kDa; 110kDa
NCBI Official Full Name
sodium bicarbonate transporter-like protein 11 isoform 3
NCBI Official Synonym Full Names
solute carrier family 4 member 11
NCBI Official Symbol
SLC4A11??[Similar Products]
NCBI Official Synonym Symbols
BTR1; CHED; CDPD1; CHED2; NABC1; dJ794I6.2
??[Similar Products]
NCBI Protein Information
sodium bicarbonate transporter-like protein 11
UniProt Protein Name
Sodium bicarbonate transporter-like protein 11
UniProt Synonym Protein Names
Bicarbonate transporter-related protein 1; Sodium borate cotransporter 1; NaBC1; Solute carrier family 4 member 11
Protein Family
Sodium bicarbonate transporter-like protein
UniProt Gene Name
SLC4A11??[Similar Products]
UniProt Synonym Gene Names
BTR1; NaBC1??[Similar Products]
UniProt Entry Name
S4A11_HUMAN
NCBI Summary for SLC4A11
This gene encodes a voltage-regulated, electrogenic sodium-coupled borate cotransporter that is essential for borate homeostasis, cell growth and cell proliferation. Mutations in this gene have been associated with a number of endothelial corneal dystrophies including recessive corneal endothelial dystrophy 2, corneal dystrophy and perceptive deafness, and Fuchs endothelial corneal dystrophy. Multiple transcript variants encoding different isoforms have been described. [provided by RefSeq, Mar 2010]
UniProt Comments for SLC4A11
SLC4A11: Transporter which plays an important role in sodium- mediated fluid transport in different organs. Prevents severe morphological changes of the cornea caused by increased sodium chloride concentrations in the stroma. In the inner ear, is involved in transport of potassium through the fibrocyte layer to the stria vascularis and is essential for the generation of the endocochlear potential but not for regulation of potassium concentrations in the endolymph. In the kidney, is essential for urinary concentration, mediates a sodium flux into the thin descending limb of Henle loop to allow countercurrent multiplication by osmotic equilibration. Involved in borate homeostasis. In the absence of borate, it functions as a Na(+) and OH(-)(H(+)) channel. In the presence of borate functions as an electrogenic Na(+) coupled borate cotransporter. Defects in SLC4A11 are the cause of corneal dystrophy and perceptive deafness (CDPD); also known as corneal dystrophy and sensorineural deafness or Harboyan syndrome. CDPD consists of congenital corneal endothelial dystrophy and progressive perceptive deafness. Inheritance is autosomal recessive. Defects in SLC4A11 are the cause of corneal endothelial dystrophy type 2 (CHED2); also known as congenital hereditary endothelial dystrophy of cornea. This bilateral corneal dystrophy is characterized by corneal opacification and nystagmus. Inheritance is autosomal recessive. Defects in SLC4A11 are the cause of corneal dystrophy Fuchs endothelial type 4 (FECD4); also known as Corneal dystrophy Fuchs endothelial late-onset. It is an ocular disorder caused by loss of endothelium of the central cornea. It is characterized by focal wart-like guttata that arise from Descemet membrane and develop in the central cornea, epithelial blisters, reduced vision and pain. Descemet membrane is thickened by abnormal collagenous deposition. Belongs to the anion exchanger (TC 2.A.31) family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Chromosomal Location of Human Ortholog: 20p12
Cellular Component: integral to plasma membrane; basolateral plasma membrane
Molecular Function: protein dimerization activity; bicarbonate transmembrane transporter activity; inorganic anion exchanger activity; symporter activity; boron transporter activity; hydrogen ion channel activity; sodium channel activity
Biological Process: proton transport; cellular cation homeostasis; fluid transport; bicarbonate transport; sodium ion transport; regulation of intracellular pH; boron transport
Disease: Corneal Dystrophy And Perceptive Deafness; Corneal Dystrophy, Fuchs Endothelial, 4; Corneal Endothelial Dystrophy 2, Autosomal Recessive
Research Articles on SLC4A11
1. To identify SLC4A11 mutants that are targets for folding-correction therapy, 54 SLC4A11 missense mutants, were identified.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.