Full Product Name
Anti-CORD2 Picoband Antibody
Product Synonym Names
Cone-rod homeobox protein; CRX; CORD2
Product Gene Name
anti-CORD2 antibody
[Similar Products]
Product Synonym Gene Name
CRX[Similar Products]
Research Use Only
For Research Use Only. Not for use in diagnostic procedures.
OMIM
AF024711 Genomic DNA
3D Structure
ModBase 3D Structure for O43186
Species Reactivity
Human
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified
Concentration
Add 0.2ml of distilled water will yield a concentration of 500ug/ml. (lot specific)
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human CORD2 (265-299aa DSLEFKDPTGTWKFTYNPMDPLDYKDQSAWKFQIL), identical to the related mouse and rat sequences.
Subcellular Localization
Nucleus.
Tissue Specificity
Retina.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.
ISO Certification
Manufactured in an ISO 13485:2003 and EN ISO 13485:2012 Certified Laboratory.
Other Notes
Small volumes of anti-CORD2 antibody vial(s) may occasionally become entrapped in the seal of the product vial during shipment and storage. If necessary, briefly centrifuge the vial on a tabletop centrifuge to dislodge any liquid in the container`s cap. Certain products may require to ship with dry ice and additional dry ice fee may apply.
Related Product Information for
anti-CORD2 antibody
Description: Cone-rod homeobox protein is a protein that in humans is encoded by the CRX gene. The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined.
Protein Function: Transcription factor that binds and transactivates the sequence 5'-TAATC[CA]-3' which is found upstream of several photoreceptor-specific genes, including the opsin genes. Acts synergistically with other transcription factors, such as NRL, RORB and RAX, to regulate photoreceptor cell-specific gene transcription. Essential for the maintenance of mammalian photoreceptors.
Product Categories/Family for anti-CORD2 antibody
Neuroscience; Sensory System; Visual System; Epigenetics and Nuclear Signaling; Transcription; Domain Families; developmental families; Transcription Factors
Applications Tested/Suitable for anti-CORD2 antibody
Western Blot (WB)
Application Notes for anti-CORD2 antibody
WB: 0.1-0.5mug/ml
Western Blot (WB) of anti-CORD2 antibody
Figure 1. Western blot analysis of CORD2 using anti-CORD2 antibody (MBS1750754).
Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.
Lane 1: HEPG2 whole cell lysates.
After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-CORD2 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for CORD2 at approximately 37KD. The expected band size for CORD2 is at 32KD.

NCBI/Uniprot data below describe general gene information for CORD2. It may not necessarily be applicable to this product.
NCBI Accession #
NP_000545.1
[Other Products]
NCBI GenBank Nucleotide #
NM_000554.5
[Other Products]
UniProt Primary Accession #
O43186
[Other Products]
UniProt Secondary Accession #
Q0QD45[Other Products]
UniProt Related Accession #
O43186[Other Products]
Molecular Weight
32261 MW
NCBI Official Full Name
cone-rod homeobox protein
NCBI Official Synonym Full Names
cone-rod homeobox
NCBI Official Symbol
CRX??[Similar Products]
NCBI Official Synonym Symbols
CRD; LCA7; OTX3; CORD2
??[Similar Products]
NCBI Protein Information
cone-rod homeobox protein
UniProt Protein Name
Cone-rod homeobox protein
UniProt Gene Name
CRX??[Similar Products]
UniProt Synonym Gene Names
CORD2??[Similar Products]
NCBI Summary for CORD2
The protein encoded by this gene is a photoreceptor-specific transcription factor which plays a role in the differentiation of photoreceptor cells. This homeodomain protein is necessary for the maintenance of normal cone and rod function. Mutations in this gene are associated with photoreceptor degeneration, Leber congenital amaurosis type III and the autosomal dominant cone-rod dystrophy 2. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some variants has not been determined. [provided by RefSeq, Jul 2008]
UniProt Comments for CORD2
Transcription factor that binds and transactivates the sequence 5'-TAATC[CA]-3' which is found upstream of several photoreceptor-specific genes, including the opsin genes. Acts synergistically with other transcription factors, such as NRL, RORB and RAX, to regulate photoreceptor cell-specific gene transcription. Essential for the maintenance of mammalian photoreceptors.
Research Articles on CORD2
1. data demonstrate the successful application of ZFN technology to generate CRX-GFP labeled hESC lines, which can be used to study and isolate photoreceptor precursors during hESC differentiation.
Precautions
All of MyBioSource's Products are for scientific laboratory research purposes and are not for diagnostic, therapeutics, prophylactic or in vivo use. Through your purchase, you expressly represent and warrant to MyBioSource that you will properly test and use any Products purchased from MyBioSource in accordance with industry standards. MyBioSource and its authorized distributors reserve the right to refuse to process any order where we reasonably believe that the intended use will fall outside of our acceptable guidelines.
Disclaimer
While every efforts were made to ensure the accuracy of the information provided in this datasheet, MyBioSource will not be liable for any omissions or errors contained herein. MyBioSource reserves the right to make changes to this datasheet at any time without prior notice.
It is the responsibility of the customer to report product performance issues to MyBioSource within 30 days of receipt of the product. Please visit our Terms & Conditions page for more information.